Frequently Asked Questions (FAQs)

1. Q: What is the shelf life of DIMA’s products?

A: The shelf life of our products is 1 year from the date you receive the goods, taking into account the recommended storage time indicated on the corresponding Certificate of Analysis (COA). During this period, if you encounter any issues while using the product, feel free to reach out to us.

2. Q: How should I store the proteins or antibodies upon receipt?

A: All DIMA’s proteins and antibodies are shipped in lyophilized form. Most of them should be stored at -20°C to -80°C for up to 12 months. Upon reconstitution, the product can be stored at 4°C for 7-15 days or at -20°C for 2-3 months. If not intended for use within one month after reconstitution, it is advisable to aliquot and store at -80°C to prevent repeated freeze-thaw cycles. Please note that PE-conjugated products can only be stored at 2°C-8°C for 6 months.For long term storage, glycerol can be added to a final concentration of 50% and stored at -20°C.

3. Q: Do you have long-term storage data on your products at room temperature? Could you conduct long-term stability studies (6 months to a year) on your lyophilized product at room temperature and share the data with me?

A: Typically, our proteins and antibodies are stored at -20oC to -80oC for up to 12 months in lyophilized form. Our stability testing data include both 20oC (normal) and 37oC (extreme) for 3 days, demonstrating the stability of our protein after long-term storage. While we don’t have protein or antibody samples stored at room temperature for 12 months, we can provide a sample stored for over 12 months for activity testing if needed. Please specify the purpose of your experiment for further assistance.

4. Q: Could we test the protein once a month for 12 months?

A: Certainly, for monthly testing over 12 months, we would require 12 vials of samples (10ug) for SDS-PAGE. The cost includes product pricing (total price for 12 vials) and a service fee for extra testing (12 * $50 = $600). Prepayment is required, and upon receipt, we will provide test data each month for 12 months. We can also ship the leftover protein upon request, with shipping costs to be covered by you.

5. Q: I ordered a protein product from your company a year ago. Later, I would like to reorder the same batch of the protein. How does DIMA Biotech ensure the quality stability of the same batch?

   A: Protein and antibody products in lyophilized (freeze-dried) form are generally highly stable under our standard storage conditions. Based on extensive internal testing and customer feedback, we have found that, when stored under the recommended conditions, many of our products can remain stable for up to 5 to 6 years. Additionally, we routinely perform quality control testing on older batches to ensure continued quality and consistent performance.

For all DIMA BIOTECH’s protein products, we offer a one-year quality guarantee starting from the date of delivery. If the product is stored and used according to the conditions specified in the COA, and any quality issues arise within this period, we will provide full after-sales support.

The one-year validity period mentioned in the COA refers to the guaranteed quality period after the customer receives the product, assuming it is stored under the recommended conditions. Below is a quality control case example from one of our regularly stocked proteins, demonstrating the long-term stability of the batch:

The biological activity evaluation on different production lot of proteins (freshly prepared (PH25A1001) Vs lyophilized format stored in -20C for more than five years (PH20H1801). The lot-to-lot variation for recombinant human CTLA-4 (Cat# PME100479) is minimal through biological activity evaluation test.

  1. Q: Why is the shipping temperature for lyophilized products listed as room temperature?

A: Experimental data has demonstrated the excellent stability of DIMA’s lyophilized products at ambient temperatures. Domestic express shipping with a 2-3 day transit period does not adversely affect product activity.

  1. Q: What is the concentration of trehalose in the lyophilized products, and does it impact their functionality?

A: Before lyophilization, our products are supplemented with a 5%~8% mass/volume solution of trehalose to ensure stability during the freeze-drying process. Post-lyophilization, we validate stability through methods like SDS-PAGE, and functionality through assays such as ELISA or FACS Binding. You can use our products with confidence.

  1. Q: How should I reconstitute lyophilized products? How is the reconstitution volume calculated, and is it necessary to follow the pre-lyophilization concentration?

A: The Certificate of Analysis (COA) accompanying your order provides the pre-lyophilization product concentration and recommended dilution volume. Using a solvent concentration that is too low or too high can impact protein stability. Before use, it is essential to centrifuge the product and reconstitute it with sterile water. Our proteins are lyophilized from 1X PBS, pH 7.4, and typically contain 5% – 8% trehalose as protectants. Reconstituting based on the pre-lyophilization concentration yields the protein in 1X PBS buffer. Alternatively, using a larger volume of water may result in a lower salt concentration in the solution. While this is generally acceptable, we advise considering your specific experimental requirements when making this choice.

  1. Q: Regarding the verification of product functionality, what analyses are available?

A: For some of our products, we currently provide verification data through ELISA or flow cytometry testing. Other activity analysis data may not be available at the moment. Please refer to the verification data charts on our website for the most up-to-date information.

  1. Q: How is the stability of different batches of DIMA products?

A: For our popular proteins and antibody products, DimAb has implemented an efficient stable cell line development process internally, significantly minimizing batch-to-batch variations in product production. Our stringent quality management system ensures product quality, providing you with confidence in usage. If you encounter any issues during use, please feel free to contact us at any time.

  1. Q: What is the endotoxin level in our product?

A: The production environment is controlled to minimize endotoxin introduction. Most of our proteins and antibodies are produced using HEK293 cells, a human cell expression system, rather than E. coli systems or other native resources. Most endotoxin concerns are linked to proteins prepared from E. coli. As a result, routine endotoxin testing is not part of our standard procedure. However, we can assure you that the endotoxin levels of our proteins are below 2 EU/μg (LAL).

1. Q: Can you send us the amino acid sequence of the proteins?

A: The amino acid sequence of our protein is available upon request. Please feel free to contact us, and we will promptly provide the requested information.

2. Q: Do you offer custom service for protein production?

A: Yes, we provide custom protein production services tailored to your specific needs. We’ll collaborate with you to design a project based on your sequence requirements. If you’re interested in a custom project, let us know, and we can provide details on pricing and timelines. Our dedicated team ensures the delivery of high-quality proteins meeting your research requirements. For any additional questions or assistance, please feel free to contact us.

3. Q: What hFc tag was used for your hFc-tagged recombinant protein, and why was it chosen?

A: We use the engineered hIgG1e2 Fc tag for our hFc-tagged recombinant proteins. This variant features specific mutations (M252Y/S254T/T256E and H433K/N434F) that enhance binding to the neonatal Fc receptor (FcRn), resulting in prolonged serum half-life and improved pharmacokinetic properties. These enhancements contribute to greater therapeutic efficacy and reduced dosing frequency.

 

1. Q: Can you let me know the extinction coefficient that was used for determining the concentration of the antibodies?

A: Due to the higher complexity of antibodies, we typically utilize the machine’s default extinction coefficient. The extinction coefficient used for determination of our full-length antibodies (HC+LC) is 0.735. The concentration was calculated using the formula A280/0.735. Generally, the predicted extinction coefficient aligns well with both UV and Bradford assay-determined concentrations, and we have verified this consistency.

2. Q: Can you provide more information about the antibody isotype mentioned on your website? Why do you have antibodies raised from Rabbit (Host Species: Rabbit) but with antibody Isotype: Rabbit/Human Fc chimeric IgG1?

A: This antibody is in a chimeric form. Initially developed with a rabbit, we then removed the rabbit Fc domain and replaced it with human IgG1 Fc. Hence, it is termed a Chimeric antibody, with the Fab portion being of rabbit origin and the Fc portion being human. This innovative design combines the advantages of rabbit antibody production with the compatibility of the human Fc region. For secondary antibody use, we recommend Goat anti-human-HRP or other conjugates.

3. Q: Will DIMA’s anti-DXD antibodies bind exatecan mesylate?

A: Our anti-DXD antibody will not bind exatecan mesylate. DIMA’s anti-DXD antibodies were originally developed by using DXD payload toxin. Exatecan Mesylate is closely related but not identical to DXd. They have structural differences.

1. Q: Which materials are used for Nanodisc Proteins?

        A: We utilize synthetic nanodiscs that are internally synthesized within our company. However, specific details regarding the composition of our nanodiscs are proprietary and confidential.

2. Q: Is it possible to purchase empty nanodiscs?

       A: Currently, we do not have empty nanodiscs available for purchase. However, we do offer nanodiscs designed for specific target proteins.

3. Q: Has the function of the protein/nanodisc been tested after lyophilization and dissolving?

       A: Yes, all our nanodiscs undergo comprehensive lyophilization and testing procedures. The data presented on our website is derived from the protein after the lyophilization and reconstitution process. The products are shipped at room temperature after lyophilization.

4. Q: Do you offer additional testing for standard Nanodisc products?

       A: Our Nanodisc proteins have been verified using an anti-Flag tag antibody. We can attempt verification using other antibodies if suitable ones are available. However, please note that for some products, we may not have an appropriate antibody in our inventory. If you have any suggestions, kindly share them with us so that we can explore the possibility of working with the recommended antibody.

5. Q: Do you offer custom Nanodisc Development?

       A: We offer custom Nanodisc development for targets beyond our current range. To provide accurate costings and timelines, we require specific details about the target and the scale of the project. Please share your specific requirements to enable us to offer a precise estimate and timeline.

For new targets, we typically conduct a test run (250mL culture volume) with the expression cDNA clone. The obtained protein from the test run, varying from ng to 100ug, will be sent to customers. The actual cost and timeline depend on specific project requirements. For instance, a protein with 12 transmembrane domains, like MDR1 (Human MDR-1 full-length protein-synthetic nanodisc – DIMA Biotechnology), will incur a higher cost for the test run compared to a protein with 4 transmembrane domains, like CLDN2 (Human CLDN2 full-length protein-synthetic nanodisc – DIMA Biotechnology).

Additionally, any other considerations for a custom project, such as unique specifications or special handling instructions, can be discussed based on the project details. The expression cDNA clone will be charged separately if not provided by customers, and we will send the DNA clone to customers in this case.

6. Q: There are multiple bands in the Nanodisc sample.

      A: We are actively optimizing our conditions to achieve better results for this protein. However, based on our experiences, proteins can exhibit bands at higher molecular weights due to post-translational modifications (PTMs) such as phosphorylation and glycosylation, or bands at lower molecular weights due to cleavage during cellular processes or sample preparation. Therefore, we suggest checking the literature to see if multiple bands are reported for the specific protein. If you come across any reference data for this protein, please feel free to share it with us so that we can further optimize our conditions.

7. Q: How much protein can you typically obtain from an 80 ml culture for VLP, MNP, or Nanodisc preparation?

     A: The yield varies by method. For VLP, you can typically expect around 1 mg, although this can depend on the specific target, as some may express poorly. MNP usually yields about 2-3 mg. Nanodisc yields are lower, generally in the microgram range, which makes it relatively high-cost. However, due to its small size, Nanodisc can be purified via anti-tag antibodies, which results in high purity and homogeneity of final protein sample. In contrast, VLP and MNP are larger, meaning that while recombinant proteins can be enriched, they also contain some adjacent membrane proteins and molecules, resulting in lower purity compared to Nanodisc proteins.

8. Q: What is the total amount of protein and corresponding lipid and polymer? What is the protein measurement method you used for quantification?

     A: For Nanodisc protein measurement, we use standard BCA method. The amount indicated on the tube is the target protein amount excluding lipid and synthetic polymers. The molecular weight of lipid and polymer on synthetic Nanodisc is in average around 146kDa. Therefore, the amount of these two component can be calculated with following equation: The amount of lipid+synthetic polymer=amount of protein X (146/molecular weight of target protein). 

9. Q: What is the molecular weight of empty synthetic Nanodisc copolymer complex?

     A: The average molecular weight is around 146kDa. The detailed calculation can be referenced at this paper (Hall SCL., et al. 2018).

10. Q: Have any of your customers used synthetic nanodisc membrane proteins in display experiments? Which immobilization methods would you recommend? According to Dima Biotech webside, nanodisc membrane proteins have been tested in SPR and ELISA applications – how were they immobilized on solid phase in these applications?

        A: In terms of immobilization, we normaly use standard ELISA coating approach. It works fine. We also tried with sanwich approach, which first coat with anti-FLAG antibody, then Nanodisc protein. Both approaches work well. However, there are a couple of cases that certain Nanodisc protein might not work with direct coating approach when tested with conformational epitope antibody. For linear epitope, like anti-FLAG, it works all the time with direct coating approach or indirect sanwich approach.

11. Q: Do you offer biotinylated nanodisc membrane proteins?

        A: Currently we do not offer as a standard product format. However, we have developed the technology platform and can offer as a custom service project for you.

12. Q: Could you please provide more information on the stability, storage conditions and buffer compatibility of your polymer-based nanodiscs? For example, are they compatible with buffers containing detergents, e.g. Tween-20, or low concentrations of organic solvents e.g. DMSO or ethanol? Are there any other limitations when developing the assays with polymer-based nanodisc membrane proteins?

       A: Our copolymer is SMA based technology. Detergent could potentially affect the Nanodisc. However, we used the low concentration Tween-20 in the buffer during ELISA assay. So far, it is OK. In terms of reaction buffer pH, we recommend it should not be lower than pH5.0. SMA copolymer is sensitive to low pH condition. High concentration of divalent cations will also affect SMA based copolymer. We suggest you do not include more than 5mM concentration of divalent cations. We did not test experimental condition in DMSO or ethanol.

13. Q: Purity and purification methods of nanodisc

        A:  We used M2 affinity purification approach to purify the protein. According to the SDS-PAGE gel, the purity of the protein is estimated to be around 85%, even though there are faint high MW bands above the major product band, which is normal feature for transmembrane protein SDS-PAGE gel. The origin of these high MW bands could be due to multimers or PTM caused. If needed, we can run a WB assay to verify the authenticity of these high MW bands.

14. Q: What issues should be paid attention to when using your Nanodisc protein in ELISA and WB experiments?

        A: Due to the slight shedding of light/heavy chains of anti-Flag M2 antibodies during purification, we are unable to use anti-mouse secondary antibody for Flag-tag nanodisc in indirect ELISA or WB experiments. 

15. Q: Can Nanodisc structures tolerate divalent metal ions?

        A: Whether Nanodisc structures can tolerate divalent metal ions depends not only on the concentration of the metal but also on how the metal ions are added. If magnesium chloride (MgCl2) or another divalent metal ion is added all at once to reach a final concentration of 5 mM, precipitation may occur. However, if the metal ions are added gradually, even to a final concentration of 5 mM, precipitation can be prevented. Concentrations below 5 mM generally do not cause precipitation, as long as the ions are added carefully.

16. Q: Is the Nanodisc sensitive to any detergents? Can it be stable in a solution with detergent?

        A:  The nanodisc can resist low concentrations of detergent, such as 0.1% Tween 20, which is commonly used as a wash buffer during assays. However, higher concentrations of detergents may affect the stability of the nanodisc. It is recommended to use lower detergent concentrations to maintain optimal stability.

17. Q: What is the tag sequence for the Strep-Flag dual-tagged nanodisc protein?

        A: The nanodisc contains both a FLAG tag and a Twin-Strep tag:
              FLAG tag: The sequence is DYKDDDDK.
             Twin-Strep tag: The sequence is SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK.
             The FLAG tag is a singular tag, while the Strep tag is a twin sequence of two connected Strep tags.

18. Q: What is the size of the nanodisc

         A: The diameter of disc is around 10-15nm. The thickness is similar to lipid bilayer, which is around 4-5nm.

19. Q: What is the lipid composition of the nanodisc?

         A: Since our synthetic nanodisc is made of from native membrane, which is different from MSP based technology, the composition of the lipid is the same as original lipids from the HEK293 cells used as production cell line.

20. Q: I assume that when purchasing 10ug Nanaodisc, we are ordering 10ug of the protein of interest, correct?

         A: Yes, we use BCA assay to test the protein concentration and get the final protein amount. This test will not be affected by lipid and synthetic polymer. It will be the actual amount of protein of target.

21. Q: Can SEC be used to determine the molecular weight of membrane proteins or multimeric complexes in Nanodisc, PeptiNanodisc, or detergent formats?

        A: SEC (Size-Exclusion Chromatography) is widely used for membrane protein analysis; however, its interpretation is highly dependent on the sample format.

For SMA- or MSP-based Nanodiscs, SEC elution behavior does not directly correlate with molecular weight. Instead, it primarily reflects the hydrodynamic radius (Stokes radius) of the particle. The elution profile is strongly influenced by the lipid-to-polymer or lipid-to-MSP ratio, which determines the overall nanodisc size. Consequently, larger nanodiscs elute earlier, whereas smaller nanodiscs elute later. Therefore, SEC elution profiles are not recommended as a standalone metric for molecular weight determination in these systems.

In contrast, for membrane proteins in detergent or PeptiNanodisc formats, SEC behavior is generally more consistent and shows a stronger correlation with molecular weight, making it more suitable for molecular weight estimation.

22 Q: Why can false positives occur when detecting the binding of antibodies to Flag-tagged nanodisc proteins using anti-mouse secondary antibodies?

A: Residual mouse-derived anti-Flag antibodies used during purification can be recognized by anti-mouse secondary antibodies, leading to false-positive signals.

  1. Q: When the test antibody is diluted and mixed with AME100002 according to the mass ratio, the Ab-AME100002 complex is formed. Can the labeled antibody be stored, and what are the storage conditions?

A: We have not conducted specific tests on this. We recommend preparing and using the labeled antibody immediately.

  1. Q: What is the principle behind DiTagTMpH-sensitive IgG labeling reagent, and how is the internalization rate calculated?

A: DiTagTM pH-sensitive IgG labeling reagent utilizes a pH-sensitive fluorophore-labeled Fc-binding protein that binds to IgG antibodies from different species, forming a fluorescently labeled antibody-reagent complex. Upon internalization of the antibody, the surrounding pH becomes acidic, significantly enhancing the fluorescence signal of the antibody-reagent complex. The fluorescence intensity serves as an indicator of antibody internalization activity. By measuring the strength of the fluorescence signal, researchers can assess the efficiency of antibody internalization into cells. The positivity rate is calculated based on the customer’s experimental design, representing the percentage of positively internalized cells.

  1. Q: For DiTagTMpH-sensitive IgG labeling reagent, what is the achievable Mean Fluorescence Intensity (MFI)? How much difference in cell signaling values is considered significant? Are there cells that may not be detectable?

A: The achievable Mean Fluorescence Intensity (MFI) for DiTagTM pH-sensitive IgG labeling reagent can vary based on different cell types and flow cytometry setups. There is a risk of not detecting antigen-low expressing cells. The MFI values can differ for various cell types, and the experimental data from DIMA Biotechnology indicates an MFI of FITC at 3*10^4.

  1. Q: What is the difference between AME100001 and AME100002?

A: The main difference lies in their affinity for different IgG antibodies. Please refer to the table below for more information.

SpeiesImmunoglobulinAME100001AME100002
HumanIgG(normal)++++++++
IgG1++++++++
IgG2++++++++
IgG3-++++
IgG4++++++++
IgM--
IgA--
IgE--
IgD--
Fab++++
κ light chains--
L light chains--
ScFv++-
MouseIgG1+++++
IgG2a++++++++
IgG2b++++++
IgG3+++++
RatIgG1-+
IgG2a-++++
IgG2b-++
IgG2c+++
BovineIgG++++++
CatIgG++++-
ChickenIgG-+
DogIgG+++++++
GoatIgG+/-++
Guinea PigIgG++++++
HamsterIgG+++
HorseIgG++++++
PigIgG++++++
RabbitIgG+++++++
SheepIgG+/-++

5. Q: Are AME series antibody internalization reagents sterile? How should they be used in cell-based assays?

A: No, AME series antibody internalization reagents are not supplied as sterile products. For cell-based experiments, we recommend the following solutions:

  1. Add penicillin-streptomycin (P/S) or other appropriate antibiotics to the culture medium during the assay.
  2. If antibiotics cannot be used in your experimental system, dilute the reagent to the working concentration first, then sterilize it by filtration through a 0.22 μm filter before use.